PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911913.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 304aa    MW: 34933 Da    PI: 6.2643
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911913.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-5481361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeek...ewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eelv +yL++kv++ k+++ evi++vd+y++ePwdL+ ++k++++   ewyfFs +d+ky++g+r+nrat++g+Wkatg+dk+v
  XP_010911913.1   8 VPPGFRFHPTEEELVGYYLARKVASLKIDI-EVIRDVDLYRIEPWDLQDRCKNGDEeqaEWYFFSYKDRKYPSGTRTNRATAAGFWKATGRDKPV 101
                     69****************************.99**************964444322246************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ls k++++g++ktLvfykgrap+g+ktdW+mheyrl
  XP_010911913.1 102 LS-KSRVIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 136
                     **.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-606157IPR003441NAC domain
PROSITE profilePS5100558.638157IPR003441NAC domain
PfamPF023657.4E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDQLESCVPP GFRFHPTEEE LVGYYLARKV ASLKIDIEVI RDVDLYRIEP WDLQDRCKNG  60
DEEQAEWYFF SYKDRKYPSG TRTNRATAAG FWKATGRDKP VLSKSRVIGM RKTLVFYKGR  120
APNGRKTDWI MHEYRLQSGE HGPIQEEGWV VCRAFRKPSP NQRQCFNNYD PTYYNNLDGQ  180
YGREPRFMES YQGGNFREQP TGCRGESKNT TLLSHVLELP QLHSPSLSTS LSTKEFFEPN  240
VASDEEHAAK RSDCEGQMID WKFLDKLLSS QLNESASSSM PVVPVNYDGG AQSQGDQFLA  300
LFDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-52315710168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911913.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9C8W91e-102NAC30_ARATH; NAC domain-containing protein 30
TrEMBLM0SGV21e-140M0SGV2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P22360_0011e-140(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25943791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.13e-95vascular related NAC-domain protein 7